填空题Position Available High-level secretary needed for a firm located in central Los Angeles. Applicants should have good communication skills, reasonable computer skills and be able to type 80 wpm. The ability to speak French and Spanish is an advantage. Applicants must have 3-5 years'experience with at least two years as secretary to top management. Applicants should be prepared to work with high-level contacts while presenting a calm and pleasant demeanor. Send resume and cover letter together with two references to RTS International, Box 1244 Los Angeles CA. RTS International Box 1244 Los Angeles CA April 1,2005 Dear Sir or Madam, I am writing in reply to your advertisement for a secretarial position which I saw in the Gazette on Monday. After my graduation from secretarial school, I worked for a number of local companies for around four years, and developed my secretarial skills. I can type 100 wpm, and I speak good Spanish, as well as basic French, which I am keen to improve. For the last two years I have been the personal assistant to the president of QBC, an Internet shipping company. I enjoy my work, but I am looking for more of a challenge. I'm sure that your company can provide me with that challenge. I look forward to hearing from you. Yours sincerely, Miriam Masters Statements: Job Application About Miriam Masters Position A high—level secretary Applying for a secretarial position Requirements Skms Good (56) skills，reasonable computerskills and minimum typing speed of80 wpm Languages(advantage) French and Spanish Good Spanish and basic French (57) Two years as a secretary to (58) (59) years'experience as a secre-tary；now works as the (60) to thepresident of QBC，an Internet ship-ping company；has held this positionfor two years

填空题The subject of this lecture is horology

填空题Oxford Street, in England "s capital city, is not known for cultural events. But for ten days in early 2001, it was the address for a fascinating art "performance": Michael Landy"s Break Down. Inside an old department store, the 37-year old artist destroyed every one of his 7,006 personal possessions. The Break Down took Landy three years to plan. His socks, his fridge, his passport-everything he owned was numbered and labeled. The details were entered into a computer. Then a huge industrial machine for breaking things was moved into the empty C&A clothes store. Finally, on 24 February 2001, Landy and ten assistants in blue uniforms began breaking each listed item. One assistant pulled apart Landy"s Saab car. Another tore up Landy"s family photographs. Others "worked" on his furniture and clothes. Then the pieces were placed in plastic yellow boxes for Landy to push into the machine. He finished with personal items that he could never replace: his paintings, his father"s old coat. The result was six tons of useless rubbish. Landy said he didn"t want to make people feel bad. But many of the 45,000 people that came to see the Break Down were unhappy. Some felt it wasn"t right to throw away things that the poor could use. Others said Landy was doing the whole thing to become famous. Almost everybody, however, was excited in some way by the event, "What was he trying to say?" they wondered. Landy gave a number of different answers to this question. "The only thing you can take away from this," he once said, "is your experience of it. That"s the most important thing to me: it"s not for sale. "

填空题In1783,theTreatyofPariswassigned,whichindicatedtheendoftheAmericanRevolution.ThevictorytheAmericanpeopleachievedenabledthemtoestablishanindependentnation,andintroducedanewera.From1789to1865,theUnitedStatesgraduallyformeditsnationalidentityandestablisheditspoliticalandlegalinstitution.WhentheUnitedStatesbegantodevelopintoanindustrialandurbansociety,theprincipleofassembly-linemassproductionwasestablished,andtechnologybegantobringvastmaterialbenefitstotheindustrializedNorth.TheSouth,however,remainedagricultural.Withanincreasingnumberoffarmlaborersleavingthelandtoworkinurbanbusinessesandfactories,citiesgrewbiggerandbigger.Withthesesignificantdevelopments,theUnitedStatesbecameanewrisingnation.Theeconomicboombroughtanoverwhelmingsenseofoptimismandhopetothepeople.Thismoodandspirit,togetherwiththetraditionalAmericanculturalheritagePuritanism,naturallybroughtoutaromanticfeeling.Thisfeeling,asajointoutcomeofthenationalandinternationalfactors,developeditselfintoanationalliterarymovement-Romanticism.AsaEuropeanliterarymovement,RomanticismoriginatedandstrengthenedinGermany,FranceandEnglandinthemiddleofthe18thcentury.ItreachedtheNewWorldinthefirstdecadeofthe19thcenturywhenmoreandmoreAmericanstraveledtoEuropeandbroughtbackwiththemtheinfluenceofEuropeanRomanticism.Romanticismwasrebelliousinspirit.Itemphasizedfreedomandindividualism,believingthatimaginationandemotionweresuperiortorulesandreason.AmericanromanticauthorswerequiteresponsivetothestimuluswhichAmericanexperienceoffered.Theirsubjectswereoftenthenationalidealsofindividualismanddemocracy,historyandfrontierlifeofthenewnation.TranscendentalismorRomanticIdealismemergedafter1830whenabookentitledNature,byRalphWaldoEmerson,waspublishedin1836.ItpushedAmericanRomanticismintoanewstage—AmericanTranscendentalism,thesummitofAmericanRomanticism.Transcendentalistsplacedemphasisonspiritorthesupernatural,andstressedtheimportanceoftheindividual.Menshouldtrustthemselvesandrelyonthemselves.Theycanmaketheirownlawsandliveaccordingtotheirownindependentprinciples.TheNewWorldgiveseachtheopportunitytobecomeacompletelyfreeandindependentindividual.SoTranscendentalismdisregardedexternalauthority,traditionandlogicaldemonstration.Thoreau,Hawthorne,Longfellow,andWhitmanwerealltranscendentalistsinsomeformorother.Inliterature,Romanticismfoundrecurrentthemesintheevocationorcriticismofthepast,thecultof"sensibility"withitsemphasisonwomenandchildren,theisolationoftheartistornarrator,andrespectfornature.Furthermore,severalromanticauthors,suchasEdgarAllanPoeandNathanielHawthorne,basedtheirwritingsonthesupernaturalandhumanpsychology.Romanticismtendedtoregardsatireassomethingunworthyofseriousattention,aprejudicestillinfluentialtoday.TheprecursorsofRomanticisminEnglishpoetrygobacktothemiddleofthe18thcentury,includingfiguressuchasJosephWartonandhisbrotherThomasWarton,ProfessorofpoetryatOxfordUniversity.Josephmaintainedthatinventionandimaginationwerethechiefqualitiesofapoet.ThomasChattertonisgenerallyconsideredthefirstRomanticpoetinEngland.TheScottishpoetJamesMacphersoninfluencedtheearlydevelopmentofRomanticismwiththeinternationalsuccessofhisOssiancycleofpoemspublishedin1762,inspiringbothGoetheandtheyoungWalterScott.BothChattertonandMacpherson"sworkinvolvedelementsoffraud,aswhattheyclaimedwasearlierliteraturethattheyhaddiscoveredorcompiledwas,infact,entirelytheirownwork.Inaword,AmericanTranscendentalismandtheRomanticAgewasoneofthemostproductiveliteratureperiodsinAmericanhistory.Inthisperiod,Americanliteraturebecamematureandgrewintocomplexityanddiversity.Completethesummarybelowwithinformationfromthepassage,usingnomorethanthreewordsforeachblank.AftertheUSsteppedintoanindustrialandurbansociety,citiesbecamebigger.Theeconomicboomproducedasenseof1whichtogetherwithPuritanismdevelopedintoanationalliterarymovement,Romanticism.EarlyRomanticismwas2inspiritwhichemphasizedfreedomandindividualism.After1830,AmericanRomanticismreachedits3,whichisknownasTranscendentalismorRomanticIdealism.Duringthisperiod,spiritorthesupernaturalandimportanceoftheindividualwerestressed.Inliterature,Romanticismfoundrecurrentthemesintheevocationorcriticismofthepast,regardingsatireassomething4seriousattention.RomanticismhelpedAmericanliteraturegrowinto5.

填空题 In this section, you will hear a short passage. There are 10 missing words or phrases. Fill in the blanks with the exact words or phrases you hear on the tape. Remember to write the answers on the answer sheet. Bells have been in {{U}}(21) {{/U}} for a long lime. They were used by the Chinese about {{U}}(22) {{/U}} and the oldest bell ever found is around 7,000 years old. Today, we live in a world of mass communications and {{U}}(23) {{/U}} clocks, so it is easy to forget what {{U}}(24) {{/U}} part of everyday life bells used to be. Bells told people of happy events, such as {{U}}(25) {{/U}}, or sometimes had to announce {{U}}(26) {{/U}} such as a death or a funeral. Sometimes bells were used for giving people warnings of an enemy's {{U}}(27) {{/U}} or spreading the good news of victory. In many places today, bells are perhaps most {{U}}(28) {{/U}} announcing when {{U}}(29) {{/U}} services are going to take place. They are also frequently rung {{U}}(30) {{/U}} and continue to play a part in many people's lives.

填空题England is in north-west Europe and is the largest country in the UK.(The UK also includes Scotland, Wales and Northern Ireland.)Thepopulation of England is about 53 millions. The capital city is London 【M1】______and other major cities include Birmingham, Leeds, Sheffield andManchester. The currency is in the pound sterling. England is only 34 km 【M2】______from France and is linked a tunnel under the English Channel. 【M3】______Outside the metropolitan areas, England is mostly agricultural land, 【M4】______hills and mountains. The climate is temperate with mild winter and 【M5】______warm summers. English is an official language of England. England is a cosmopolitan, 【M6】______multiculture country with a lot of immigration, particularly from Indian 【M7】______sub-continent. Other languages spoken in England include of Punjabi, 【M8】______Urdu, Bengali and Poland. The national sport of England is football. 【M9】______Other popular sports include Rugby and cricket. England is famous for many things, include its royal family, London 【M10】______landmarks such as Big Ben, and the writer William Shakespeare.

填空题It is probable that until two hundred years ago, Antarctica (南极洲) had never been seen by any human eyes. The 1 people who are known to have seen it were hunters on ships in 1819. Two years later, one of them ma 2 to land there even though conditions prevented him from 3 (explore) very far. Larger scientific expeditions later came to the Antarctic to find out more. By the end of the nineteenth century they had succeeded in mapping the coast of the continent, in spite of the fact that Antarctica is almost entirely covered by a thick 4 of ice which in places stretches far 5 the edge of the land onto the sea. There was something else which attracted people to Antarctica 6 scientific research. This was the South Pole. A number of art 7 to reach it were made in the early years of the twentieth century, but the first person to get there was the Norwegian, Roald Amundsen, in 1911. 8 (travel) with dogs to pull sledges that carried his party"s supplies, he arrived at the pole five weeks before his rivals, a British group 9 by Robert Scott. 10 the terrible weather conditions, many nations now have scientific bases on Antarctica, carrying out research on a great range of subjects.

填空题Questions 61 to 65 are based on the following passage. Paper is different from other waste produce because it comes from a sustainable resource: trees. Unlike the minerals and oil used to make plastics and metals, trees are replaceable. Paper is also biodegradable, so it does not pose as much threat to the environment when it is discarded. While 45 out of every 100 tons of wood fibre used to make paper in Australia comes from waste paper, the rest comes directly from virgin fibre from forests and plantations. By world standard this is a good performance since the worldwide average is 33 per cent waste paper. Governments have encouraged waste paper collection and sorting schemes and at the same time, the paper industry has responded by developing new recycling technologies that have paved the way for even greater utilisation of used fibre. As a result, industry's use of recycled fibres is expected to increase at twice the rate of virgin fibre over the coming years. Already, waste paper constitutes 70% of paper used for packaging and advances in the technology required to remove ink from the paper have allowed a higher recycled content in newsprint and writing paper. To achieve the benefits of recycling, the community must also contribute. We need to accept a change in the quality of paper products; for example stationery may be less white and of a rougher texture. There also needs to be support from the community for waste paper collection programs. Not only do we need to make the paper available to collectors hut it also needs to be separated into different types and sorted from contaminants such as staples, paperclips, string and other miscellaneous items. There are technical limitations to the amount of paper which can be recycled and some paper products cannot be collected for reuse. These include paper in the form of books and permanent records, photographic paper and paper which is badly contaminated. The four most common sources of paper for recycling are factories and retail stores which gather large amounts of packaging material in which goods are delivered, also offices which have unwanted business documents and computer output, paper converters and printers and lastly households which discard newspapers and packaging material. The paper manufacturer pays a price for the paper and may also incur the collection cost. Summary: From the point of view of recycling, paper has two advantages over minerals and oil in that firstly it comes from a resource which is sustainable and secondly it is less threatening to our environment when we throw it away because it is (61) Although Australia's record in the reuse of waste paper is good, it is still necessary to use a combination of recycled fibre and (62) to make new paper. The paper industry has contributed positively and people have also been encouraged by (63) to collect their waste on a regular basis. One major difficulty is the removal of ink from used paper but (64) are being made in this area. However, we need to learn to accept paper which is generally of a lower (65) than before and to sort our waste paper by removing contaminants before discarding it for collection.

填空题What is hydroplaning? It may happen on the following occasions: a 1 moves too quickly along a wet road; a layer of water accumulates 2 ; they lift up and lose traction; the driver 3 . What actions has NASA taken? They 4 a lot of data. They produced a 5 They published the equation 6 , along with information about the 7 of water depth, 8 , tire tread, and vehicle weight on hydroplaning risk. Safety tips Use well-treaded, fully 9 tires. Do not slam on the 10 if you skid on wet pavement.

填空题A clock gains 10 seconds every hour. If we adjust it to the correct time, it is 5: 30. And 24 hours later, what is the correct time now?

填空题What occurs once in every month, twice in every moment, but not once in a thousand years?

填空题AmassivedinosaurhatcherycontainingthousandsoffossilizedeggsanddozensofembryoshasbeendiscoveredinthePatagoniaregionofArgentina,afindthatshouldgiveresearcherstheirfirstinsightintotheembryonicdevelopmentofthesefascinatinganimals.Theeggswerelaidbysauropods-placid,plant-eatingdinosaurswithlongnecksandtailsandasmallhead-overanareaofatleastasquaremilealongancientstreambeds,anAmericanandArgentineteamsaidatanewsconferenceinWashington,DC.Thefindrepresentsthefirstembryonicfossilscontainingremnantsofskin,thefirstsauropodembryosandthefirstdinosaurembryosfoundintheSouthernHemisphere.Perhapsmoreimportantly,thedepositcontainsembryoswithabroadcross-sectionofgestationalagesandshouldthusprovidepaleontologistswiththeirfirstgoodlookathowthecreaturesdevelopedduringtheirearlystagesoflife."Therearemorethan200sitesaroundtheworldwithfossilsofdinosaureggs,butonlyahalfdozenthatcontainembryos,"saidpaleontologistPhilipCurrieoftheRoyalTyrrellMuseuminAlberta."Andthesearethemostspectacularembryoseverfound."Theteammembersliterallystumbledacrossthespecimens.Ontheseconddayoftheirexpeditionlastyear,theyfoundthesite,whichwaslitteredwithfossilsofeggshells."Youcouldn'ttakeastepwithoutwalkingonshellfragments,"saidLuisM.Chiappe,oftheAmericanMuseumofNaturalHistoryinNewYorkCity,co-leaderoftheexpedition.TheteamnamedthesiteAucaMabuevoforitstremendousabundanceofeggs(huevosinSpanish).Theeggswereround,about5to6inchesindiameter.Hadtheyhatched,thebabydinosaursinsidewouldhavestartedlifeamere15incheslong,butgrowntoalengthof45feet.Manyoftheeggscontainednotonlyfossilsofthebonesoftheembryonicdinosaurs,butalsofossilsofskinfragments."Thatisremarkablebecausetheskinissuchadelicatestructureandisveryrarelypreservedinfossilform,"Chiappesaid."Theskinofadinosaurembryohasneverbeendiscoveredbefore."Becausetheteamhasdiscoveredspecimensofdifferentgestationalages,researcherswillbeabletochartthegrowthoftheembryoswithintheeggs,measuringthegrowthrateofbones,forexample,andtheorderinwhichvariousorgansformed."Wecanknowthepatternofdevelopmentofdinosaursthatlivedmillionsofyearsagoandcompareittomodemreptiles,"Chiappesaid."Thathasnotbeenpossiblewithanyotherdinosaurs."Theteamdoesnotknowyetpreciselywhichtypeofsauropoddinosaurproducedtheeggs,butthediscoveryoftinyteethinsomeeggsprovidesanintriguingclue.Oneembryoalonehasatleast32individual,pencil-shapedteeth,eachsmallenoughtofiteasilyintothecapital"O"atthebeginningofthissentence.Theonlysauropoddinosaurswithteeththisshapethatwerealiveduringtheperiodwhenthefossilswereformedweretitanosaurs.TheremainsoftitanosaursarecommonnearAucaMahuevo,makingitverylikelythattheembryosbelongtothisgroup.

填空题Exercise is essential for mind, body and 1 . It"s one of the best ways to 2 when all around you everything seems more and more unbalanced and the world becomes ever more fast and 3 . Don"t groan because this is yet another article about 4 . The reason why there are so many is that it is 5 good for you. There are plenty of reasons why you should exercise and very few—for most of us—why you shouldn"t. Exercise improves muscle 6 and provides quick changes in 7 . It improves muscle power and promotes good posture—the way in which you hold your body when sitting or standing. It helps 8 muscle imbalances which can lead to injuries. It provides quick improvement in 9 such as thighs, stomach and upper arms. It improves the condition of the heart and lungs and 10 .

填空题 There are 10 blanks in the passage. Use the words given in the box to fill in the blanks, changing the form where necessary. Use only one word in each blank. There are two extra words which you do not need to use. Remember to write the answers on the Answer Sheet. differ, experience, inform, little, patience, prefer, quality, rely, limit, tame, familiar, violate Though bounty hunting is very dangerous work, it is a job that is not {{U}}(81) {{/U}} to men; some women are bounty hunters, too. Mackenzie Green is a woman and a very well respected bounty hunter. In fact, she has been called "the most successful bounty hunter in the US. " Why is she so successful? She {{U}}(82) {{/U}} more on her brain than on physical strength. "A good bounty hunter uses gut feelings and people skills to pick up {{U}}(83) {{/U}} on the whereabouts of a skip," she says. This means that she trusts her feelings about people and situations to tell if they are telling her the truth or if they are trying to hide something. She also doesn't carry a gun. "You can't {{U}}(84) {{/U}} a bull by hitting it with a stick," she says. This means that violence always leads to more violence. She {{U}}(85) {{/U}} to use good people skills to get people to trust her. Then, when they {{U}}(86) {{/U}} expect it, she arrests them, when asked what {{U}}(87) {{/U}} make a good bounty hunter, Mackenzie Green has this to say, "Being a bounty hunter is difficult work; a person has to have {{U}}(88) {{/U}} in serf defense, things like judo and boxing, as well as a {{U}}(89) {{/U}} with weapons. A person also must be part detective to track down the skips, part lawyer to know what the {{U}}(90) {{/U}} state laws allow, and part actor to try and get people to give you information that they otherwise wouldn't give out. A person must also be patient and lucky. "

填空题What is the value of x, if x is a whole number, in the sum below? X3+(2X)2 =8×3

填空题Cultural Attitudes towards Time According to anthropologist Irving Hallowell, there is no evidence that humans have an inborn sense of time. A person' s temporal concepts are probably determined largely by culture. One study showed that infants, after a few days of listening to speech around them, will move their heads and limbs in rhythm with the speech they hear. As children develop, they adapt more fully to their tem-poral culture. This temporal culture influences language, music, poetry and dance. It also affects relationships. We tend to get along well with people who share our sense of time. One particular cultural attitude towards time is found in polychronie cultures. Some Mediterra-nean and southwest Asian Cultures are usually placed in this category. Such cultures emphasise re-lationships among people, flexible timing of appointments, and the careful completion of processes rather than strict schedules. Polychronic people seldom feel that time is being wasted. They tend to consider each activity valuable on its own, not just as part of a larger process. Polychronic people tend to have many projects going on at the same time, and they may shift frequently from one task to another. They change plans often. For polychronic people, work time is not clearly separable from personal time, so business meetings are considered a form of socialising. Monochronic cultures, on the other hand, are oriented towards tasks and schedules. Cultures usually considered monochromic can be found in northern Europe, North America, and some parts of eastern Asia.Monoehronie people feel that time is tangible and inflexible and that " time is money. " They do one thing at a time and concentrate on each thing. Time and job commitments are very important to them and they tend to follow plans rigidly. Also, monochromic people clearly sep-arate their work and personal time, and they place a high value on privacy. As you might expect, people from polyehronic and monochromic cultures often misunderstand each other because of their different senses of time. For example, because a monochromic culture is highly compartmentalized, monochromic people tend to sequence conversations as well as tasks. They would not, for instance, interrupt a phone call in order to greet another person who just came into the room In contrast, polychronic people are comfortable with having multiple conversations at the same time. They would consider it rude not to greet someone who entered during a phone conversation. Complete the summary below by choosing for each blank no more than, three words .from the passage. Cultures may have either a (71) or a monochromic conception of time. Cultures with a polychromic view of time follow a (72) timetable. People from polychronic cultures tend to work on several (73) at the same time. On the other hand, people in (74) perceive events and tasks as being more compartmentalized. In this culture, jobs and even conversations should follow a certain (75) . Everything in these cultures seems inflexible, and has its own place and time.

填空题Since moving pictures were invented a century ago, a new way of distributing entertainment to consumers has e (66) about once every generation. Each such inno (67) has changed the industry irreversibly; each has been acco (68) by a period of fear mixed with exhilaration. The a (69) of digital technology, (70) translates music, pictures and text into the zeros and ones of computer language, marks one of those p (71) . This may sound familiar, because the digital revolution, and the explosion of choice that would go (72) it, has been shown for some time. In 1992, John Malone, chief executive of TCI, an American cable giant, welcomed the "500-channel universe. " Digital television was about to deliver everything (73) pizzas to people's living rooms. When the entertainment companies (74) (try) out the technology, it worked fine--but not at a price (75) people were prepared to pay. Those 500 channels eventually arrived but via the Internet and the PC (76) than through television. The digital revolution was starting to affect the entertainment business in (77) (expect) ways. Eventually it will change every aspect of it, from the way cartoons are made to the way films are screened to the way people buy music. That much is clear. (78) nobody is sure of is how it will affect the economics of the business. New technologies always contain within them both t (79) and opportunities. They have the potential both to make the companies in the business a great deal r (80) , and to sweep them away. Old companies always fear new technology.

填空题Although one might not think so from some of the criticism of it, advertising is essential to the kind of society in which people in the United Kingdom, and a very large part of the world at large, live. Advertising is necessary as a means of communicating with others. It is also a way of telling people about the goods and services that are offered. If it were not for advertising, some goods information would never reach the ears of many people. Advertising helps a great deal to raise the people"s standard of living. In talking about advertising, one should not think only in terms of commercial on television, or an advertisement in the newspapers or periodicals. In its widest sense, advertising includes many other activities such as packaging, shop displays and even the spoken word of the salesman. After all, the roots of advertising are to be found in the market place. For many years it was thought that it was enough to produce goods and supply services. It is only more recently that it has become increasingly understood that the production of goods is a waste of resources unless those goods can be sold at a fair price within a reasonable time span. In the competitive society in which we live, it is essential that we go out and sell what we have to offer, and advertising plays an important role in this respect, whether selling at home or in export markets. About 2 percent of the U.K. gross national product is spent on advertising. But it must not be thought that this advertising tries to sell goods to consumers who do not want them. Of course, advertising does try to attract the interest of the potential consumer, but if the article purchased does not match up to the standards that the advertising suggests that it will, it is obviously unlikely that the article will sell well.

填空题WhatshouldbethetimeonClockD?A.B.C.D.

填空题Rearrange the letters given and make one word that uses all of the letters． AEDMNOORRSTT